Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (3 families) |
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) automatically mapped to Pfam PF01281 |
Protein Ribosomal protein L9 N-domain [55660] (3 species) |
Species Escherichia coli [TaxId:562] [160581] (29 PDB entries) Uniprot P0A7R1 1-58 |
Domain d2aw4h2: 2aw4 H:1-58 [144873] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw4h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4h2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]} mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl
Timeline for d2aw4h2:
View in 3D Domains from other chains: (mouse over for more information) d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 |