![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() automatically mapped to Pfam PF00347 |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Escherichia coli [TaxId:562] [160796] (27 PDB entries) Uniprot P02390 1-81! Uniprot P02390 82-176 |
![]() | Domain d2aw4g2: 2aw4 G:82-176 [144871] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw4g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4g2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig qvaadlrayrrpepykgkgvryadevvrtkeakkk
Timeline for d2aw4g2:
![]() Domains from other chains: (mouse over for more information) d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 |