Lineage for d2aw4g1 (2aw4 G:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873804Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 873841Domain d2aw4g1: 2aw4 G:1-81 [144870]
    Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
    Representative structure
    complexed with mg

Details for d2aw4g1

PDB Entry: 2aw4 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2aw4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw4g1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOP Domain Coordinates for d2aw4g1:

Click to download the PDB-style file with coordinates for d2aw4g1.
(The format of our PDB-style files is described here.)

Timeline for d2aw4g1: