Lineage for d2aw4c2 (2aw4 C:61-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799829Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 799881Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 799900Domain d2aw4c2: 2aw4 C:61-124 [144866]
    Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
    Representative structure
    complexed with mg

Details for d2aw4c2

PDB Entry: 2aw4 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d2aw4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw4c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOP Domain Coordinates for d2aw4c2:

Click to download the PDB-style file with coordinates for d2aw4c2.
(The format of our PDB-style files is described here.)

Timeline for d2aw4c2: