SCOPe 2.06: Domain d2aw2x2: 2aw2 X:34-137

Lineage for d2aw2x2 (2aw2 X:34-137)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein B- and T-lymphocyte attenuator CD272 [158869] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [158870] (1 PDB entry)
Uniprot Q7Z6A9 34-137
Domain d2aw2x2: 2aw2 X:34-137 [144864]
Other proteins in same PDB: d2aw2a2, d2aw2b1, d2aw2b2, d2aw2x3, d2aw2y1, d2aw2y2
automated match to d2aw2a1
complexed with ni

Details for d2aw2x2

PDB Entry: 2aw2 (more details), 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex

PDB Compounds: (X:) B and T lymphocyte attenuator

SCOPe Domain Sequences for d2aw2x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw2x2 b.1.1.1 (X:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]}
cdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeek
nisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvk

SCOPe Domain Coordinates for d2aw2x2:

Click to download the PDB-style file with coordinates for d2aw2x2.
(The format of our PDB-style files is described here.)

Timeline for d2aw2x2: