Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein B- and T-lymphocyte attenuator CD272 [158869] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158870] (1 PDB entry) Uniprot Q7Z6A9 34-137 |
Domain d2aw2a1: 2aw2 A:34-137 [144863] Other proteins in same PDB: d2aw2a2, d2aw2b1, d2aw2b2, d2aw2x3, d2aw2y1, d2aw2y2 complexed with ni |
PDB Entry: 2aw2 (more details), 2.8 Å
SCOPe Domain Sequences for d2aw2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} cdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeek nisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvk
Timeline for d2aw2a1: