Class j: Peptides [58231] (151 folds) |
Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) |
Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
Protein Ribosomal protein S21, RpsU [161310] (1 species) |
Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
Domain d2avyu1: 2avy U:3-53 [144862] Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOPe Domain Sequences for d2avyu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2avyu1: