Lineage for d2avyt1 (2avy T:2-86)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985989Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1985990Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1985991Protein Ribosomal protein S20 [46994] (2 species)
  7. 1985992Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 1986005Domain d2avyt1: 2avy T:2-86 [144861]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2avyt1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2avyt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2avyt1:

Click to download the PDB-style file with coordinates for d2avyt1.
(The format of our PDB-style files is described here.)

Timeline for d2avyt1: