Lineage for d2avys1 (2avy S:2-80)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408957Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1408958Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1408959Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1408960Protein Ribosomal protein S19 [54572] (2 species)
  7. 1408961Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1408970Domain d2avys1: 2avy S:2-80 [144860]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avyt1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg

Details for d2avys1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2avys1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avys1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2avys1:

Click to download the PDB-style file with coordinates for d2avys1.
(The format of our PDB-style files is described here.)

Timeline for d2avys1: