SCOPe 2.08: Domain d2avym1: 2avy M:1-114

Lineage for d2avym1 (2avy M:1-114)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
   contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
   automatically mapped to Pfam PF00416

6. Protein Ribosomal protein S13 [46948] (2 species)

7. Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
   Uniprot P0A7S9 1-114

8. Domain d2avym1: 2avy M:1-114 [144854]
   Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
   Representative structure
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2avym1

PDB Entry: 2avy, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2avym1:

Sequence; same for both SEQRES and ATOM records:

>d2avym1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

Timeline for d2avym1:

• d2avym1 first appeared in SCOP 1.75
  
• d2avym1 appears in SCOPe 2.07