Lineage for d2avyf1 (2avy F:1-100)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862903Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 862904Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 862905Protein Ribosomal protein S6 [54997] (4 species)
  7. 862908Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 862919Domain d2avyf1: 2avy F:1-100 [144848]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    complexed with mg

Details for d2avyf1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d2avyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOP Domain Coordinates for d2avyf1:

Click to download the PDB-style file with coordinates for d2avyf1.
(The format of our PDB-style files is described here.)

Timeline for d2avyf1: