Lineage for d2avyd1 (2avy D:1-205)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208250Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1208251Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1208252Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1208253Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1208257Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 1208268Domain d2avyd1: 2avy D:1-205 [144845]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg

Details for d2avyd1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2avyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

SCOPe Domain Coordinates for d2avyd1:

Click to download the PDB-style file with coordinates for d2avyd1.
(The format of our PDB-style files is described here.)

Timeline for d2avyd1: