SCOP 1.75: Domain d2avue1: 2avu E:5-160

Lineage for d2avue1 (2avu E:5-160)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.64: FlhC-like [160929] (1 superfamily)
   3 domains; d1 & d2 are similar three-helical bundles, with d1 containing an HTH motif; d3: zinc finger of a rubredoxin-like fold

4. Superfamily e.64.1: FlhC-like [160930] (1 family)

5. Family e.64.1.1: FlhC-like [160931] (1 protein)
   Pfam PF05280

6. Protein Flagellar transcriptional activator FlhC [160932] (1 species)

7. Species Escherichia coli [TaxId:562] [160933] (1 PDB entry)
   Uniprot P0ABY7 5-160

8. Domain d2avue1: 2avu E:5-160 [144840]
   Other proteins in same PDB: d2avua1, d2avub1, d2avuc1, d2avud1
   complexed with zn

Details for d2avue1

PDB Entry: 2avu, 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription

PDB Compounds: (E:) Flagellar transcriptional activator flhC

SCOP Domain Sequences for d2avue1:

Sequence; same for both SEQRES and ATOM records:

>d2avue1 e.64.1.1 (E:5-160) Flagellar transcriptional activator FlhC {Escherichia coli [TaxId: 562]}
sivqeardiqlamelitlgarlqmlesetqlsrgrliklykelrgspppkgmlpfstdwf
mtweqnvhasmfcnawqfllktglcngvdavikayrlyleqcpqaeegpllaltrawtlv
rfvesgllqlsscnccggnfithahqpvgsfacslc

Timeline for d2avue1:

• d2avue1 is new in SCOP 1.75
  
• d2avue1 appears in SCOPe 2.01
  
• d2avue1 appears in the current release, SCOPe 2.08