![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD8 [48734] (3 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [158864] (2 PDB entries) Uniprot P10300 22-136 |
![]() | Domain d2atpd_: 2atp D: [144838] automated match to d2atpb1 complexed with nag |
PDB Entry: 2atp (more details), 2.4 Å
SCOPe Domain Sequences for d2atpd_:
Sequence, based on SEQRES records: (download)
>d2atpd_ b.1.1.1 (D:) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} liqtpssllvqtnhtakmscevksiskltsiywlrerqdpkdkyfeflaswssskgvlyg esvdkkrniilessdsrrpflsimnvkpedsdfyfcatvgspkmvfgtgtkltvv
>d2atpd_ b.1.1.1 (D:) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} liqtpssllvqtnhtakmscevksissiywlrerqdpkdkyfeflaswssskgvlygesv dkkrniilessdsrrpflsimnvkpedsdfyfcatvgspkmvfgtgtkltvv
Timeline for d2atpd_: