SCOP 1.75: Domain d2arjl1: 2arj L:1-107

Lineage for d2arjl1 (2arj L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)

8. Domain d2arjl1: 2arj L:1-107 [144835]
   Other proteins in same PDB: d2arja2, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl2, d2arjq1, d2arjr1
   automatically matched to 2ARJ A:1-107

Details for d2arjl1

PDB Entry: 2arj, 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab

PDB Compounds: (L:) YTS 105.18 antigen binding region Light chain

SCOP Domain Sequences for d2arjl1:

Sequence; same for both SEQRES and ATOM records:

>d2arjl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
divmtqspsslavsagervtlnckasqnvrnniawyqqkpgqspklliyyasyrytgvpd
rftgdgfgtdftlainsvqaddaafyycqriynspytfgagtkleli

Timeline for d2arjl1:

• d2arjl1 is new in SCOP 1.75
  
• d2arjl1 appears in SCOPe 2.01
  
• d2arjl1 appears in the current release, SCOPe 2.08