Lineage for d2arjb2 (2arj B:114-228)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785887Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 785896Domain d2arjb2: 2arj B:114-228 [144832]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjh1, d2arjl1, d2arjl2, d2arjq1, d2arjr1

Details for d2arjb2

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (B:) YTS 105.18 antigen binding region Heavy chain

SCOP Domain Sequences for d2arjb2:

Sequence, based on SEQRES records: (download)

>d2arjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdqkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2arjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
ltssvtsstwpsqtvtcnvahpasstkvdqkivpr

SCOP Domain Coordinates for d2arjb2:

Click to download the PDB-style file with coordinates for d2arjb2.
(The format of our PDB-style files is described here.)

Timeline for d2arjb2: