Lineage for d2aq3c_ (2aq3 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758513Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)
  8. 1758685Domain d2aq3c_: 2aq3 C: [144826]
    Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3f1, d2aq3f2, d2aq3h1, d2aq3h2
    automated match to d2aq3a1

Details for d2aq3c_

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (C:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2aq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2aq3c_:

Click to download the PDB-style file with coordinates for d2aq3c_.
(The format of our PDB-style files is described here.)

Timeline for d2aq3c_: