Lineage for d2aq3c_ (2aq3 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d2aq3c_: 2aq3 C: [144826]
    Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3f1, d2aq3f2, d2aq3h1, d2aq3h2
    automated match to d2aq3a1

Details for d2aq3c_

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (C:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2aq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2aq3c_ are not available.

Timeline for d2aq3c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aq3a1, d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3e_, d2aq3f1, d2aq3f2, d2aq3g_, d2aq3h1, d2aq3h2