SCOPe 2.02: Domain d2ak4u2: 2ak4 U:119-247

Lineage for d2ak4u2 (2ak4 U:119-247)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)

8. Domain d2ak4u2: 2ak4 U:119-247 [144823]
   Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d1, d2ak4e1, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4j1, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4p1, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4u1
   automatically matched to 2AK4 E:119-247
   complexed with iod

Details for d2ak4u2

PDB Entry: 2ak4, 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

PDB Compounds: (U:) SB27 T cell receptor beta chain

SCOPe Domain Sequences for d2ak4u2:

Sequence; same for both SEQRES and ATOM records:

>d2ak4u2 b.1.1.2 (U:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2ak4u2:

• d2ak4u2 first appeared in SCOP 1.75
  
• d2ak4u2 appears in SCOPe 2.01
  
• d2ak4u2 appears in SCOPe 2.03
  
• d2ak4u2 appears in the current release, SCOPe 2.08