| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (30 PDB entries) |
| Domain d2ak4p2: 2ak4 P:119-247 [144819] Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d1, d2ak4e1, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4j1, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4p1, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4u1 automatically matched to 2AK4 E:119-247 complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOPe Domain Sequences for d2ak4p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4p2 b.1.1.2 (P:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
Timeline for d2ak4p2:
View in 3DDomains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4n2, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |