| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) |
| Domain d2ak4p1: 2ak4 P:3-118 [144818] Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t2, d2ak4u2 automatically matched to 2AK4 E:3-118 complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOPe Domain Sequences for d2ak4p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4p1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcaspglageyeqyfgpgtrltvte
Timeline for d2ak4p1:
View in 3DDomains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4n2, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |