SCOP 1.75: Domain d2ak4p1: 2ak4 P:3-118

Lineage for d2ak4p1 (2ak4 P:3-118)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d2ak4p1: 2ak4 P:3-118 [144818]
   Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t2, d2ak4u2
   automatically matched to 2AK4 E:3-118
   complexed with iod

Details for d2ak4p1

PDB Entry: 2ak4, 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

PDB Compounds: (P:) SB27 T cell receptor beta chain

SCOP Domain Sequences for d2ak4p1:

Sequence; same for both SEQRES and ATOM records:

>d2ak4p1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcaspglageyeqyfgpgtrltvte

Timeline for d2ak4p1:

• d2ak4p1 is new in SCOP 1.75
  
• d2ak4p1 appears in SCOPe 2.01
  
• d2ak4p1 appears in the current release, SCOPe 2.08