| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
| Domain d2ak4j2: 2ak4 J:119-247 [144815] Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d1, d2ak4e1, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i1, d2ak4j1, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4p1, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t1, d2ak4u1 automatically matched to 2AK4 E:119-247 complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOP Domain Sequences for d2ak4j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4j2 b.1.1.2 (J:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
Timeline for d2ak4j2:
View in 3DDomains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i1, d2ak4i2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |