Lineage for d2ak4i2 (2ak4 I:117-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361045Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2361063Domain d2ak4i2: 2ak4 I:117-206 [144813]
    Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d1, d2ak4e1, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4j1, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4p1, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4u1
    automatically matched to 2AK4 D:117-206
    complexed with iod

Details for d2ak4i2

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (I:) SB27 T cell receptor alpha chain

SCOPe Domain Sequences for d2ak4i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4i2 b.1.1.2 (I:117-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2ak4i2:

Click to download the PDB-style file with coordinates for d2ak4i2.
(The format of our PDB-style files is described here.)

Timeline for d2ak4i2: