Lineage for d2ak4d1 (2ak4 D:1-116)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105448Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 1105460Domain d2ak4d1: 2ak4 D:1-116 [144808]
    Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t2, d2ak4u2
    complexed with iod

Details for d2ak4d1

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (D:) SB27 T cell receptor alpha chain

SCOPe Domain Sequences for d2ak4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qkvtqaqteisvvekedvtldcvyetrdttyylfwykqppsgelvflirrnsfdeqneis
gryswnfqkstssfnftitasqvvdsavyfcalsgfyntdklifgtgtrlqvfp

SCOPe Domain Coordinates for d2ak4d1:

Click to download the PDB-style file with coordinates for d2ak4d1.
(The format of our PDB-style files is described here.)

Timeline for d2ak4d1: