Lineage for d2aclf2 (2acl F:203-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012381Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 2012384Species Mouse (Mus musculus) [TaxId:10090] [158810] (2 PDB entries)
    Uniprot Q9Z0Y9 203-443
  8. 2012389Domain d2aclf2: 2acl F:203-443 [144803]
    Other proteins in same PDB: d2acla_, d2aclb2, d2aclc_, d2acld3, d2acle_, d2aclf3, d2aclg_, d2aclh3
    automated match to d2aclb1
    complexed with l05, rea

Details for d2aclf2

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (F:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d2aclf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aclf2 a.123.1.1 (F:203-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
qlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivs
vqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynre
dfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqht
yvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
v

SCOPe Domain Coordinates for d2aclf2:

Click to download the PDB-style file with coordinates for d2aclf2.
(The format of our PDB-style files is described here.)

Timeline for d2aclf2: