Lineage for d2aclf1 (2acl F:204-443)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776757Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 776760Species Mouse (Mus musculus) [TaxId:10090] [158810] (1 PDB entry)
    Uniprot Q9Z0Y9 203-443
  8. 776763Domain d2aclf1: 2acl F:204-443 [144803]
    Other proteins in same PDB: d2acla1, d2aclc1, d2acle1, d2aclg1
    automatically matched to 2ACL B:204-443
    complexed with l05, rea

Details for d2aclf1

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (F:) Oxysterols receptor LXR-alpha

SCOP Domain Sequences for d2aclf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aclf1 a.123.1.1 (F:204-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
lspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivsv
qeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynred
fakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhty
vealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOP Domain Coordinates for d2aclf1:

Click to download the PDB-style file with coordinates for d2aclf1.
(The format of our PDB-style files is described here.)

Timeline for d2aclf1: