| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) ![]() |
| Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins) |
| Protein Oxysterols receptor LXR-alpha [109988] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [158810] (1 PDB entry) Uniprot Q9Z0Y9 203-443 |
| Domain d2aclf1: 2acl F:204-443 [144803] Other proteins in same PDB: d2acla1, d2aclc1, d2acle1, d2aclg1 automatically matched to 2ACL B:204-443 complexed with l05, rea |
PDB Entry: 2acl (more details), 2.8 Å
SCOP Domain Sequences for d2aclf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aclf1 a.123.1.1 (F:204-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
lspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivsv
qeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynred
fakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhty
vealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
Timeline for d2aclf1: