Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins) |
Protein Oxysterols receptor LXR-alpha [109988] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [158810] (1 PDB entry) Uniprot Q9Z0Y9 203-443 |
Domain d2acld1: 2acl D:204-443 [144802] Other proteins in same PDB: d2acla1, d2aclc1, d2acle1, d2aclg1 automatically matched to 2ACL B:204-443 complexed with l05, rea |
PDB Entry: 2acl (more details), 2.8 Å
SCOP Domain Sequences for d2acld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acld1 a.123.1.1 (D:204-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]} lspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivsv qeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynred fakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhty vealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
Timeline for d2acld1: