Lineage for d2aclb1 (2acl B:204-443)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923618Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 923621Species Mouse (Mus musculus) [TaxId:10090] [158810] (1 PDB entry)
    Uniprot Q9Z0Y9 203-443
  8. 923622Domain d2aclb1: 2acl B:204-443 [144801]
    Other proteins in same PDB: d2acla_, d2aclc_, d2acle_, d2aclg_
    complexed with l05, rea

Details for d2aclb1

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (B:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d2aclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aclb1 a.123.1.1 (B:204-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
lspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivsv
qeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynred
fakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhty
vealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOPe Domain Coordinates for d2aclb1:

Click to download the PDB-style file with coordinates for d2aclb1.
(The format of our PDB-style files is described here.)

Timeline for d2aclb1: