Lineage for d2aclb1 (2acl B:203-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728865Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 2728868Species Mouse (Mus musculus) [TaxId:10090] [158810] (2 PDB entries)
    Uniprot Q9Z0Y9 203-443
  8. 2728871Domain d2aclb1: 2acl B:203-443 [144801]
    Other proteins in same PDB: d2acla_, d2aclb2, d2aclc_, d2acld3, d2acle_, d2aclf3, d2aclg_, d2aclh3
    complexed with l05, rea

Details for d2aclb1

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (B:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d2aclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aclb1 a.123.1.1 (B:203-443) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
qlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivs
vqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynre
dfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqht
yvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
v

SCOPe Domain Coordinates for d2aclb1:

Click to download the PDB-style file with coordinates for d2aclb1.
(The format of our PDB-style files is described here.)

Timeline for d2aclb1: