Lineage for d2abze1 (2abz E:6-66)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891950Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 891951Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 891952Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein)
  6. 891953Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 891954Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)
  8. 891958Domain d2abze1: 2abz E:6-66 [144799]
    Other proteins in same PDB: d2abza1, d2abzb1
    automatically matched to 2ABZ C:5-66
    complexed with zn; mutant

Details for d2abze1

PDB Entry: 2abz (more details), 2.16 Å

PDB Description: crystal structure of c19a/c43a mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase a
PDB Compounds: (E:) Metallocarboxypeptidase inhibitor

SCOP Domain Sequences for d2abze1:

Sequence, based on SEQRES records: (download)

>d2abze1 g.30.1.1 (E:6-66) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcipy
v

Sequence, based on observed residues (ATOM records): (download)

>d2abze1 g.30.1.1 (E:6-66) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpytgqcrttcipyv

SCOP Domain Coordinates for d2abze1:

Click to download the PDB-style file with coordinates for d2abze1.
(The format of our PDB-style files is described here.)

Timeline for d2abze1: