SCOPe 2.08: Domain d2abze_: 2abz E:

Lineage for d2abze_ (2abz E:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family)

5. Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)

6. Protein automated matches [190471] (1 species)
   not a true protein

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [187391] (1 PDB entry)

8. Domain d2abze_: 2abz E: [144799]
   Other proteins in same PDB: d2abza_, d2abzb_, d2abzc1
   automated match to d1dtva_
   complexed with zn; mutant

Details for d2abze_

PDB Entry: 2abz, 2.16 Å

PDB Description: crystal structure of c19a/c43a mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase a

PDB Compounds: (E:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d2abze_:

Sequence, based on SEQRES records:

>d2abze_ g.30.1.1 (E:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcipy
v

Sequence, based on observed residues (ATOM records):

>d2abze_ g.30.1.1 (E:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpytgqcrttcipyv

Timeline for d2abze_:

• d2abze_ first appeared in SCOP 1.75, called d2abze1
  
• d2abze_ appears in SCOPe 2.07