SCOP 1.75: Domain d2abzc1: 2abz C:5-66

Lineage for d2abzc1 (2abz C:5-66)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family)

5. Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein)

6. Protein Carboxypeptidase inhibitor [57622] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)

8. Domain d2abzc1: 2abz C:5-66 [144797]
   Other proteins in same PDB: d2abza1, d2abzb1
   complexed with zn; mutant

Details for d2abzc1

PDB Entry: 2abz, 2.16 Å

PDB Description: crystal structure of c19a/c43a mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase a

PDB Compounds: (C:) Metallocarboxypeptidase inhibitor

SCOP Domain Sequences for d2abzc1:

Sequence; same for both SEQRES and ATOM records:

>d2abzc1 g.30.1.1 (C:5-66) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
pdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcip
yv

Timeline for d2abzc1:

• d2abzc1 is new in SCOP 1.75
  
• d2abzc1 appears in SCOPe 2.01
  
• d2abzc1 appears in the current release, SCOPe 2.08