Lineage for d2abzc1 (2abz C:5-66)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586152Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2586153Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 2586154Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)
  6. 2586155Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 2586156Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)
  8. 2586158Domain d2abzc1: 2abz C:5-66 [144797]
    Other proteins in same PDB: d2abza_, d2abzb_, d2abzd_, d2abze_, d2abzf_
    complexed with zn; mutant

Details for d2abzc1

PDB Entry: 2abz (more details), 2.16 Å

PDB Description: Crystal structure of C19A/C43A mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
PDB Compounds: (C:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d2abzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abzc1 g.30.1.1 (C:5-66) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
pdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcip
yv

SCOPe Domain Coordinates for d2abzc1:

Click to download the PDB-style file with coordinates for d2abzc1.
(The format of our PDB-style files is described here.)

Timeline for d2abzc1: