![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily) disulfide-rich, alpha+beta |
![]() | Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) ![]() |
![]() | Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins) |
![]() | Protein Carboxypeptidase inhibitor [57622] (1 species) |
![]() | Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries) |
![]() | Domain d2abzc1: 2abz C:5-66 [144797] Other proteins in same PDB: d2abza_, d2abzb_, d2abzd_, d2abze_, d2abzf_ complexed with zn; mutant |
PDB Entry: 2abz (more details), 2.16 Å
SCOPe Domain Sequences for d2abzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abzc1 g.30.1.1 (C:5-66) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} pdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcip yv
Timeline for d2abzc1: