SCOPe 2.04: Domain d2aa1b1: 2aa1 B:1-146

Lineage for d2aa1b1 (2aa1 B:1-146)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (6 PDB entries)

8. Domain d2aa1b1: 2aa1 B:1-146 [144793]
   Other proteins in same PDB: d2aa1a_, d2aa1c_
   complexed with hem

Details for d2aa1b1

PDB Entry: 2aa1, 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi

PDB Compounds: (B:) Hemoglobin beta-C chain

SCOPe Domain Sequences for d2aa1b1:

Sequence; same for both SEQRES and ATOM records:

>d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv
skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs
aftgevqaafqkfmavvvsslgkqyr

Timeline for d2aa1b1:

• d2aa1b1 first appeared in SCOP 1.75
  
• d2aa1b1 appears in SCOPe 2.03
  
• d2aa1b1 appears in SCOPe 2.05
  
• d2aa1b1 appears in the current release, SCOPe 2.08