Lineage for d2a9ha1 (2a9h A:23-119)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058900Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1058901Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1058902Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1058919Protein Potassium channel protein [56901] (2 species)
  7. 1058920Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1058955Domain d2a9ha1: 2a9h A:23-119 [144789]
    Other proteins in same PDB: d2a9he1

Details for d2a9ha1

PDB Entry: 2a9h (more details)

PDB Description: nmr structural studies of a potassium channel / charybdotoxin complex
PDB Compounds: (A:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9ha1 f.14.1.1 (A:23-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq

SCOPe Domain Coordinates for d2a9ha1:

Click to download the PDB-style file with coordinates for d2a9ha1.
(The format of our PDB-style files is described here.)

Timeline for d2a9ha1: