![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins) |
![]() | Protein Cell death protein 4, CED-4 [158663] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158664] (1 PDB entry) Uniprot P30429 1-108 |
![]() | Domain d2a5yb2: 2a5y B:1-108 [144787] Other proteins in same PDB: d2a5ya_, d2a5yb1, d2a5yb3, d2a5yc1, d2a5yc2 complexed with atp, mg |
PDB Entry: 2a5y (more details), 2.6 Å
SCOPe Domain Sequences for d2a5yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5yb2 a.77.1.3 (B:1-108) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} mlceiecralstahtrlihdfeprdaltylegkniftedhseliskmstrlerianflri yrrqaselgplidffnynnqshladfledyidfainepdllrpvviap
Timeline for d2a5yb2: