Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.80: CED-4 C-terminal domain-like [158326] (1 protein) similar domain architecture to AAA+ helicases |
Protein Cell death protein 4, CED-4 [158327] (1 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158328] (1 PDB entry) Uniprot P30429 386-543 |
Domain d2a5yb1: 2a5y B:386-543 [144786] Other proteins in same PDB: d2a5ya_, d2a5yb2, d2a5yb3, d2a5yc1 complexed with atp, mg |
PDB Entry: 2a5y (more details), 2.6 Å
SCOPe Domain Sequences for d2a5yb1:
Sequence, based on SEQRES records: (download)
>d2a5yb1 a.4.5.80 (B:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} sdedrsalafavvmppgvdipvklwscvipvdicsneeeqlddevadrlkrlskrgalls gkrmpvltfkidhiihmflkhvvdaqtiangisileqrlleignnnvsvperhipshfqk frrssasemypktteetvirpedfpkfmqlhqkfydsl
>d2a5yb1 a.4.5.80 (B:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} sdedrsalafavvmppgvdipvklwscvipveqlddevadrlkrlskrgallsgkrmpvl tfkidhiihmflkhvvdaqtiangisileqrlleietvirpedfpkfmqlhqkfydsl
Timeline for d2a5yb1: