Lineage for d2a5yb1 (2a5y B:386-543)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722829Family a.4.5.80: CED-4 C-terminal domain-like [158326] (1 protein)
    similar domain architecture to AAA+ helicases
  6. 1722830Protein Cell death protein 4, CED-4 [158327] (1 species)
  7. 1722831Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158328] (1 PDB entry)
    Uniprot P30429 386-543
  8. 1722832Domain d2a5yb1: 2a5y B:386-543 [144786]
    Other proteins in same PDB: d2a5ya_, d2a5yb2, d2a5yb3, d2a5yc1
    complexed with atp, mg

Details for d2a5yb1

PDB Entry: 2a5y (more details), 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex
PDB Compounds: (B:) ced-4

SCOPe Domain Sequences for d2a5yb1:

Sequence, based on SEQRES records: (download)

>d2a5yb1 a.4.5.80 (B:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sdedrsalafavvmppgvdipvklwscvipvdicsneeeqlddevadrlkrlskrgalls
gkrmpvltfkidhiihmflkhvvdaqtiangisileqrlleignnnvsvperhipshfqk
frrssasemypktteetvirpedfpkfmqlhqkfydsl

Sequence, based on observed residues (ATOM records): (download)

>d2a5yb1 a.4.5.80 (B:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sdedrsalafavvmppgvdipvklwscvipveqlddevadrlkrlskrgallsgkrmpvl
tfkidhiihmflkhvvdaqtiangisileqrlleietvirpedfpkfmqlhqkfydsl

SCOPe Domain Coordinates for d2a5yb1:

Click to download the PDB-style file with coordinates for d2a5yb1.
(The format of our PDB-style files is described here.)

Timeline for d2a5yb1: