Lineage for d2a5gb_ (2a5g B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558148Protein Cholera toxin [56410] (1 species)
  7. 2558149Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)
  8. 2558155Domain d2a5gb_: 2a5g B: [144785]
    Other proteins in same PDB: d2a5ga1
    automated match to d2a5db1
    complexed with gtp, mg, na

Details for d2a5gb_

PDB Entry: 2a5g (more details), 2.66 Å

PDB Description: Cholera toxin A1 subunit bound to ARF6(Q67L)
PDB Compounds: (B:) Cholera enterotoxin, A chain

SCOPe Domain Sequences for d2a5gb_:

Sequence, based on SEQRES records: (download)

>d2a5gb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgs

Sequence, based on observed residues (ATOM records): (download)

>d2a5gb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqfvrhddgyvst
sislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggipys
qiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihh
appgs

SCOPe Domain Coordinates for d2a5gb_:

Click to download the PDB-style file with coordinates for d2a5gb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5gb_: