SCOPe 2.08: Domain d2a5fb_: 2a5f B:

Lineage for d2a5fb_ (2a5f B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Cholera toxin [56410] (1 species)

7. Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)

8. Domain d2a5fb_: 2a5f B: [144784]
   Other proteins in same PDB: d2a5fa_
   automated match to d2a5db1
   complexed with gol, gtp, mg, na, nad

Details for d2a5fb_

PDB Entry: 2a5f, 2.02 Å

PDB Description: cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6

PDB Compounds: (B:) Cholera enterotoxin, A chain

SCOPe Domain Sequences for d2a5fb_:

Sequence; same for both SEQRES and ATOM records:

>d2a5fb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
dklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyvst
sislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggipys
qiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihh
appgs

Timeline for d2a5fb_:

• d2a5fb_ first appeared in SCOP 1.75, called d2a5fb1
  
• d2a5fb_ appears in SCOPe 2.07