Lineage for d2a0lb1 (2a0l B:24-237)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058900Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1058901Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1058902Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1058913Protein Potassium channel KVAP [90107] (1 species)
  7. 1058914Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries)
  8. 1058918Domain d2a0lb1: 2a0l B:24-237 [144782]
    Other proteins in same PDB: d2a0lc1, d2a0ld1, d2a0le1, d2a0lf1
    automatically matched to 2A0L A:24-237
    complexed with k

Details for d2a0lb1

PDB Entry: 2a0l (more details), 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0lb1 f.14.1.1 (B:24-237) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]}
hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp
agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad
aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv
patpigkvigiavmltgisaltlligtvsnmfqk

SCOPe Domain Coordinates for d2a0lb1:

Click to download the PDB-style file with coordinates for d2a0lb1.
(The format of our PDB-style files is described here.)

Timeline for d2a0lb1: