SCOP 1.75: Domain d2a0la1: 2a0l A:24-237

Lineage for d2a0la1 (2a0l A:24-237)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel KVAP [90107] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries)

8. Domain d2a0la1: 2a0l A:24-237 [144781]
   Other proteins in same PDB: d2a0lc1, d2a0ld1, d2a0le1, d2a0lf1
   complexed with k

Details for d2a0la1

PDB Entry: 2a0l, 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex

PDB Compounds: (A:) Voltage-gated potassium channel

SCOP Domain Sequences for d2a0la1:

Sequence; same for both SEQRES and ATOM records:

>d2a0la1 f.14.1.1 (A:24-237) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]}
hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp
agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad
aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv
patpigkvigiavmltgisaltlligtvsnmfqk

Timeline for d2a0la1:

• d2a0la1 is new in SCOP 1.75
  
• d2a0la1 appears in SCOPe 2.01
  
• d2a0la1 appears in the current release, SCOPe 2.07