Lineage for d1zvya1 (1zvy A:2-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739534Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2739547Domain d1zvya1: 1zvy A:2-125 [144780]
    Other proteins in same PDB: d1zvyb_
    complexed with gol, po4

Details for d1zvya1

PDB Entry: 1zvy (more details), 1.63 Å

PDB Description: crystal structure of the vhh d3-l11 in complex with hen egg white lysozyme
PDB Compounds: (A:) immunoglobulin heavy chain antibody variable domain

SCOPe Domain Sequences for d1zvya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscaasgstdsieymtwfrqapgkaregvaalythtgntyyt
dsvkgrftisqdkaknmaylrmdsvksedtaiytcgatrkyvpvrfaldqssydywgqgt
qvtv

SCOPe Domain Coordinates for d1zvya1:

Click to download the PDB-style file with coordinates for d1zvya1.
(The format of our PDB-style files is described here.)

Timeline for d1zvya1: