![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
![]() | Superfamily d.94.1: HPr-like [55594] (1 family) ![]() |
![]() | Family d.94.1.1: HPr-like [55595] (2 proteins) |
![]() | Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries) |
![]() | Domain d1zvvw1: 1zvv W:1-84 [144779] Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2 automatically matched to 1ZVV J:1-84 complexed with iod; mutant |
PDB Entry: 1zvv (more details), 2.98 Å
SCOP Domain Sequences for d1zvvw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvvw1 d.94.1.1 (W:1-84) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]} mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte itliaqgedeqealeklaayvqee
Timeline for d1zvvw1: