Lineage for d1zvvw_ (1zvv W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965914Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 2965915Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 2965926Domain d1zvvw_: 1zvv W: [144779]
    Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2
    automated match to d1mo1a_
    protein/DNA complex; complexed with iod

Details for d1zvvw_

PDB Entry: 1zvv (more details), 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex
PDB Compounds: (W:) HPr-like protein crh

SCOPe Domain Sequences for d1zvvw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvvw_ d.94.1.1 (W:) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte
itliaqgedeqealeklaayvqee

SCOPe Domain Coordinates for d1zvvw_:

Click to download the PDB-style file with coordinates for d1zvvw_.
(The format of our PDB-style files is described here.)

Timeline for d1zvvw_: