Lineage for d1zvvp1 (1zvv P:1-84)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868636Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 868637Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 868638Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 868639Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 868640Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 868650Domain d1zvvp1: 1zvv P:1-84 [144778]
    Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2
    automatically matched to 1ZVV J:1-84
    complexed with iod; mutant

Details for d1zvvp1

PDB Entry: 1zvv (more details), 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex
PDB Compounds: (P:) HPr-like protein crh

SCOP Domain Sequences for d1zvvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvvp1 d.94.1.1 (P:1-84) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte
itliaqgedeqealeklaayvqee

SCOP Domain Coordinates for d1zvvp1:

Click to download the PDB-style file with coordinates for d1zvvp1.
(The format of our PDB-style files is described here.)

Timeline for d1zvvp1: