Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries) |
Domain d1zvvp_: 1zvv P: [144778] Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2 automated match to d1mo1a_ protein/DNA complex; complexed with iod |
PDB Entry: 1zvv (more details), 2.98 Å
SCOPe Domain Sequences for d1zvvp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvvp_ d.94.1.1 (P:) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]} mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte itliaqgedeqealeklaayvqee
Timeline for d1zvvp_: