Lineage for d1zvsd2 (1zvs D:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198430Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [160074] (1 PDB entry)
  8. 1198432Domain d1zvsd2: 1zvs D:1-181 [144776]
    Other proteins in same PDB: d1zvsa1, d1zvsb_, d1zvsd1, d1zvse_
    automatically matched to 1ZVS A:1-181

Details for d1zvsd2

PDB Entry: 1zvs (more details), 2.8 Å

PDB Description: crystal structure of the first class mhc mamu and tat-tl8 complex
PDB Compounds: (D:) MHC class I antigen

SCOPe Domain Sequences for d1zvsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvsd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
gshsmkyfytsmsrpgrgqprfiavgyvddtqfvrfdsdaasqrmeprapwveqegpeyw
dretrnmktetqnapvnlrtllryynqseagshtlqrmvgcdlgpdgrllrgyeqyaydg
kdyialnedlrswtaadvaaqntqrkweaadvaesmraylegqcvewlprylekgketlq
r

SCOPe Domain Coordinates for d1zvsd2:

Click to download the PDB-style file with coordinates for d1zvsd2.
(The format of our PDB-style files is described here.)

Timeline for d1zvsd2: