![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [160074] (1 PDB entry) |
![]() | Domain d1zvsd2: 1zvs D:1-181 [144776] Other proteins in same PDB: d1zvsa1, d1zvsa3, d1zvsb_, d1zvsd1, d1zvsd3, d1zvse_ automatically matched to 1ZVS A:1-181 |
PDB Entry: 1zvs (more details), 2.8 Å
SCOPe Domain Sequences for d1zvsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvsd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} gshsmkyfytsmsrpgrgqprfiavgyvddtqfvrfdsdaasqrmeprapwveqegpeyw dretrnmktetqnapvnlrtllryynqseagshtlqrmvgcdlgpdgrllrgyeqyaydg kdyialnedlrswtaadvaaqntqrkweaadvaesmraylegqcvewlprylekgketlq r
Timeline for d1zvsd2: